TE$A

Tesamorelin is a synthetic 44-amino acid polypeptide analogue of endogenous Growth Hormone-Releasing Hormone (GHRH). It is stabilized by the attachment of a trans-3-hexenoic acid group to its N-terminal tyrosine residue, which significantly increases its resistance to enzymatic degradation by dipeptidyl peptidase-4 (DPP-4). Tesamorelin functions as a selective agonist of the GHRH receptors in the anterior pituitary, stimulating the pulsatile secretion of growth hormone (GH) while maintaining the natural negative feedback loops of the hypothalamic-pituitary-somatotropic axis. Research applications include investigations into the modulation of visceral adipose tissue (VAT), the regulation of lipid metabolism, and the potential neuroprotective effects of growth hormone secretagogues on cognitive function in models of age-related decline.

Properties

• Amino Acid Sequence: [trans-3-hexenoyl]-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
• Chemical Formula: C221H366N72O67S
• Molar Mass: 5135.86 g/mol
• CAS Number: 218949-48-5 (Free Base) / 901758-09-6 (Acetate)
• Synonyms: TH-9507, Tesamorelin Acetate